ELF404 (444    ((( Qtd/lib/ld-linux.so.2GNUV-6 Onbs_|j5LxYid~TZ`gCu:A>/; W0<e=h1{Rkqc2K#yQ[I%}fM3Sz+v\7&wDr*o" )'4!$.H9JG N^ BalPm8F]?UX,pE(t@P[<? X`!g&*S+Y 'D? Ta#p8 r6i"0Z:`0> *j=.`{z\LA\{,R)4 2dZ#F7QK::8;;{ d1GJ; xk6(H 5yQzs [ Hk6@IJD0NYb9?wXp MF ^4*:J-#iiA{؟TĮf2k5RyM  Y46'{Eh=y#` P4eV q)S]2J$j libssl3.soPR_GetOpenFileInfoPR_smprintf_freePL_strdupPR_NowPR_ClosePR_smprintf_Jv_RegisterClasses__gmon_start__libsmime3.soSEC_PKCS7DestroyContentInfoSEC_PKCS7DecodeItemlibnss3.soPK11_GetTokenNameCERT_DecodeUserNoticePK11_ProtectedAuthenticationPathPORT_ZAllocSECKEY_RSAPublicKeyTemplateCERT_CertificateTemplatePK11_PQG_ParamGenCERT_DestroyCertificatePoliciesExtensionPK11_CheckUserPasswordPK11_FindCertFromNicknamePORT_ArenaZAllocPK11_DestroyContextPR_GMTParametersPR_FormatTimeDER_GetIntegerPL_strlenSEC_GeneralizedTimeTemplateDER_GeneralizedTimeToTimeCERT_GetFirstEmailAddressSEC_QuickDERDecodeItemNSS_ShutdownPK11_GenerateKeyPairPORT_StrdupNSS_NoDB_InitCERT_DecodeCertificatePoliciesExtensionSECITEM_FreeItemNSS_InitCERT_SignedDataTemplatePORT_FreePORT_FreeArenaPORT_AllocPK11_CreateDigestContextPK11_DigestOpCERT_VerifyCertificatePK11_HashBufPORT_GetErrorPK11_SignPORT_ReallocPK11_SetPasswordFuncPK11_FindKeyByAnyCertCERT_NameToAsciiPK11_ChangePWPK11_GetBestSlotCERT_HexifyPK11_InitPinPORT_SetErrorATOB_ConvertAsciiToItemPR_GetEnvCERT_DecodeBasicConstraintValueSECITEM_AllocItemCERT_CrlTemplateCERT_CertificateRequestTemplateCERT_DestroyOidSequencePK11_NeedUserInitPR_WritePORT_NewArenaCERT_DestroyCertificatePK11_DigestFinalSEC_ASN1DecodeItemDER_UTCTimeToTimeSECKEY_ExtractPublicKeyCERT_DecodeOidSequencePK11_FreeSlotSECKEY_DestroyPrivateKeyPR_ExplodeTimeCERT_GenTime2FormattedAsciiSECKEY_DestroyPublicKeySECOID_FindOIDSECOID_FindOIDTagCERT_GetNextEmailAddressCERT_GetOidStringlibplc4.so_DYNAMIC_initPR_GetSpecialFDPL_GetNextOpt_finiPR_fprintfPL_CreateOptState_GLOBAL_OFFSET_TABLE_PL_strrchrlibplds4.solibnspr4.soPR_CleanupPR_GetErrorTextPR_OpenFilePR_ReadPR_OpenPR_GetErrorTextLengthlibpthread.so.0__errno_locationlibdl.so.2libc.so.6stdoutstrerrorfgetsmemcpyperrorreadlinkmallocisattyfflush__lxstatstrcatchdirstrstrunlinksymlinkmemsettcgetattrstrcmpsprintffclosestderrfputc__ctype_b_locfwriteexitfopenfileno_IO_stdin_used__libc_start_mainstrchrfputstcsetattrvfprintf_edata__bss_start_endSECU_GetModulePassworderrStringsSEC_BlindCheckPasswordSECU_PrintCertificatensTypeBitsGLIBC_2.0NSS_3.2GLIBC_2.3GLIBC_2.1NSS_3.4NSS_3.3NSS_3.9NSS_3.6NSS_3.5NSS_3.7         ii y B&-@ii ii ii D& C& I& F&E&B&G& ġȡ̡Сԡ.ء4ܡ:;AUu     $(,048<@DH L!P"T#X$\%`&d'h(l)p*t+x,|-/01256789<=>?@BCDĠEȠF̠GРHԠIؠJܠKLMNOPQSTVWX YZ[\^ _$`(a,b0c4d8e<f@gDhHiLjPnToXp\q`rdshtlvpwtxxy|z{}~U3}5ܟ%%h%h%h%h%h %h(%h0%h8p%h@`%hHP% hP@%hX0%h` %hh%hp% hx%$h%(h%,h%0h%4h%8h%<h%@hp%Dh`%HhP%Lh@%Ph0%Th %Xh%\h%`h%dh%hh%lh%ph%th %xh(%|h0%h8p%h@`%hHP%hP@%hX0%h` %hh%hp%hx%h%h%h%h%h%h%h%hp%Ġh`%ȠhP%̠h@%Рh0%Ԡh %ؠh%ܠh%h%h%h%h%h%h %h(%h0%h8p%h@`%hHP% hP@%hX0%h` %hh%hp% hx%$h%(h%,h%0h%4h%8h%<h%@hp%Dh`%HhP%Lh@%Ph0%Th %Xh%\h%`h%dh%hh%lh%ph%th %xh(%|h0%h8p%h@`%hHP%hP@%hX0%h` %hh%hp%hx%h%h%h%h%h%h%h1^PTRhhQVh`US[P tЋ]ÐU=u-(t(ҡ(uÉUԟt!t$ԟY]ÐU]# ju$ƍ{4$D$4$ED$|D$]u]ÍU]E u}$ ƍ@$VDž~%EЀ8.uxsuxouxu ֍&t$E<$D$>.chkD>]u}]ÉU]3 z$rD$ ED${D$$]]ÍvUE UBBB]ÐU(}} ]uGu 4$D$t$D$E$u4GD$GD$E$k;Gu1]u}]Í&E$ڍ&'UW11V1S\u 11111/L$| ($xj t${D$E$3 '4$huQit>duF$:؃otvuκF$뮋F룋$w$$t$^$1D$6{$$+$D$D$1D$D$1D$D$ $D$D$s|1$|$t$$<$D$D$  (%=$&<$t$T$~$t$T$$C뻉<$1TD$ D$$D$L$T$D$ }$tt$$ t$eu8t$ ae[^_]É$뾉t$xD$$g/*T$D$$tjƅ D$$ƅƅƅxD$$a<$ D$T$6 t$<$T$D$/y<$D$ D$R<$,T$D$+<$D$8D$<$T$D$<$&t*$D$$x 1$D$ |T$D$$D$#|D$$dt3|D$T$$$$ÐUE]&uHD$'}4$D$ ]u]Í'UWVS7$}fNjEEEUD$A}D$$EUD$E D$$t?u-t$F}D$$[^_]Í&|$U썃هD$ԍt&'U]EuD$A}}}D$$R|$E D$$]x$D$هD$$]u}]É'Uuu]=Ät"4$D$1D$4$4$]u]ÍU(]:u0T}D$4$E4$R}D$tD|$ D$ E D$E$bƋE$<$]u}]Ë(L$T$D$ ($1Ë&|$t$D$ hΐU1WVS}BU <$1D$D$4$D$D$4$e1< t(< t$9} B*< t< t9|t&'1*t$[^_]ËD$ D$D$$n1ʼn|$ȈD$$܍v'U1WVS,}u1T}44$ltM rvt9uJ4$D$D$4$t$$$G$),[^_]$(T$$1Ӊ4$D$hD$4$t$$띍G4$D$E D$Ɖ$Gg$4mt&UWVS,U@ÇEE{0TD$4$ED$$ȉT$v4$R}D$]}E䍃r}E&ut E$N|$E䋳 D$Et$ $~^EMt E$t$ E|$D$E$O^EUttD$E$t#$$T$[E$E$u<$mE,[^_]$(T$$T1$dh܋B$뵋BD$E D$E$f뚍t&UWVS,E `ç}UEUU؉E<$s}t&'<$U1D$T$+D$Ɖ<$t|Eu($$ȊT$t4$$~$}T$L4$D$1D$4$"4$J,[^_]EED$1ED$<$ E܉D$t$<$ur4$D$1D$4$4$$$T$E1$FD$U܉|$$sE܉$1L$$}T$S$<$E1҉T$D$IE܉D$1D$<$|tEEE؉U+EUUE'UWVS 3z}$~1҅t`D$ D$4$J񐍴&! t€u҃)/t [^_]Év'! t€u҃)1믉'U(uu]}} GÎ4$|0/t1|$ }t$D$4$a]u}]É|$ }͍t&U(]E'} }ut ]u}]Åt8uk}$tO>t4$|0/t/|$ }t$D$ 4$ 듉|$ }ύ멉D$ }D$4$n! t€u҃) /w! t€u҃)1 7U(uu]}}4$1D$ tW4$1ɉL$4tE8E1]u}]D$}D$$=t4~ D$=t D$(뻾ht$몋|$D$ D$ ~$됋D$ +D$D$ЍU卅WVS}GÎGG$$T$T$Yƅ|It\WtKG$D$dGWt Gt$‹$D$w녁[^_]É4$1獶UHuu ]mô}}$94$EȉD$umGẺ|$$D$+t6ẺD$G4$D$a;Eu1]u}]$<$1ɉL$$<$V뺍t&UWVS눉<$ԀD$*it&<$րD$A<$؀D$ <$ƅD$޺<$ڀD$ǺUWEVSLUEċ}1rlófz t?uTt?ut?u܀`D$Eĉ$ED$Eĉ$'FD$Eĉ$ED$Eĉ$FD$Eĉ$|$EĉD$ D$E $QL1[^_]Í&fE,,EÍt&UWVSsú$кEDž <$DD$8E t$<$D$ D$EED$E$ED$D$E$臵E@ED$ D$FD$E$0ED$ D$FD$E$-|$ED$D$ FD$E$EuF@u!&<$1ɉL$´E[^_]ËED$ D$F@D$E$2UWVSE$[EUD$E$褵EE |$D$ D$E$蕹ED$E$ED$D$E$ z1E@ED$E$Wt$FD$ D$|~D$E$轳ED$ $D$D$E$gED$ 2D$D$E$!ED$ FD$D$E$;ED$ MD$D$E$5ED$ D$D$E$ED$D$ D$ED$E$Bu,ED$ VD$D$E$v1D$E$_[^_]ÍGx$vvU]u}$ƅt\81T$|$4$4$E D$ D$4D$Ft 4$1ɉL$貱]u}]ÍvED$ ED$4D$E$뻍t&'UWVuȉS|%E{EEU }BD$ Bt$$D$9E}<$uED$EUE$D$h}D$E|$$U}BUT$<$Q<$EUT$D$Ű}<$ʴEt E1U BD$ Bt$$D$f|$}uE<$EJEUE$D$s}D$E|$$)}U<$T$<$UET$D$}<$$ ED$uuM1t|[^_]ÍU$v諴EvUWVSE '}ut$F<$<$ED$D$St$<$U tPT$<$D$t$ D$E <$D$t$ D$E <$(D$[^_]Í&$蕯U Bt&'UWVSuE4} t$F$ED$D$E$jt$ D$E|$$t$ FD$G D$E$t$ $D$G D$E$t$ ȁD$G(D$E$t$ D$E|$$[^_] UWVSUE1$D$EMD$ $D$kEU M@tD$ D$T$ $tU MD$ FD$B $ D$tU MD$ $D$B $D$tUD$ D$E $D$pM A(6tUD$ D$E $,D$9tD$E L$ DD$E$`U zPu Ĭ[^_]ËtEL$$t$UL$-$T$ 躱M AP0tUxJdlhv'|$dh$D$Tt$ldUL$ D$$M GAP4u&Ut$D$MD$D$YL$ $U B(0yUtxpdl&|$pdL$$脰t$ldET$ L$$M GA(4uUWVSUEڽ!$D$EMD$D$ $[E P g1UMBtT$ $|$GD$ D$|~D$E$2MtD$E $T$ D$tUD$ FD$E $4D$tD$E L$ t$EL$D$ ؂$\U B@0tExlLT|$TlL$$t$LlET$ L$$M GA@4u"tMT$ $rED$ D$D$ $苫U B<0xE$lML2`@HJh\X&|$l`$D$LEL$$lPET$L$$ HhD$ET$ L$$H\D$ET$ L$$FHXD$ET$ L$$M GA<4yUt$D$MD$D$fL$ $U B80ExylLd&|$dlL$$脩t$LlD$ET$ L$$gM GA84utEL$$UL$$T$ T$ M A 0MxplLt&|$lp$D$褨t$LlUL$ D$$M GA 4uUWVSUEA$D$EMD$ $D${EU M@tD$ D$T$ $!E @ u7tUD$ D$E $D$~Ĝ[^_]ÍvtMT$ $f|$ED$ D$փ$U B 0xUxphlt&'|$phL$$t$lhET$ L$$M GA 4uUWVSUEjñ$D$wElL$D$E$UM D$EBtT$ L$$U R E @tUD$ D$E $D$M A\E H`E @du1[^_]ÍvtMT$ $ED$ D$D$؂$该U Bd0tExp`\ |$\pL$$Dt$`pET$ L$$M GAd4utMT$ $ET$D$ D$ $ۤU B`0xE$pM`2L@TJhHD&|$pL$D$D`EL$$plET$L$$pThD$ET$ L$$THD$ET$ L$$ FTDD$ET$ L$$FM GA`4sUt$D$|$Mft$$L$ T$$<$ED$ɺ|$ D$JL$$<$ED$葺|$ D$D$T$譚v<$ED$Y|$ D$D$g$u2<$ED$!|$  D$pT$$=&UWVSuE轧4$D$ʹ4$ED$D$A4$}G|$衹t$ D$D$|$轙UT$UU 4$D$/|$4$St$ D$D$$oEU D$B4$D$|$4$t$ |$L$$&EU D$B4$D$[^_]Ðt&UWVS蓦ړ$Eƅ4$0D$9|$E 4$D$ D$2EED$E$5ED$D$E$詒|$E@ED$ D$E$UEED$ 2D$G D$E$G,G,ED$ @D$G$D$E$2ED$ D$E D$E$o4$1D$ёE[^_]ÍU]3zD$E$L$T$D$ Ą$K]1]ÉUW1VS,UΤBB$EU~rUGIuE1ɋ@E9}:Ur t&'EEUGTt:GA;M|׋ME L$D$E$ZE&M $5M҈UtU1ɋ29}zU8tdA9|1ɅuE1ɋx9}p E8tA9|1Ҹu,[^_]ËM| QgT^T UJGL>H묉U]E @ÇUx&;B}!R L tD$#]]1&UE]6ufu ƃ]u]Í&f=`f=Kf= 6f=!f= f= f= f="f=f=f=f=yf=df=Of=:f=%f=*f=f= f=f=f=f=f=}f=hf=Sf=>f=,f= f=f=f=f= f=f=f=#f="f=$xf=&tjf=)t\f=/tNf=Zt)f=[ID$4$X0'D$ԍ܄썃ȍ䍃܍ԍ̍Hč,뼍봍E묍Y뤍뜍t딍댍넍yȅnׅcXMB7!,7!FȎ aoφ#6|GqXfn[t&'Uuu],sƃ4$t]u]É4$t8ut$wD$4$ōU(]谞upvVD$E$v ]u]$#$T$T$̐t&$UUTut8uB]ÍUWVS\u7E}芏E$;EEEEΊD$1ɋEL$$M؉D$EL$ M D$E L$T$t$ |$$!E܅uEЉ$_\[^_]ËED$ D$D$$萏}t·E̋w9utIuԋ$߇uD$ D$ET$t$$芉E$G$D$ GD$ẺD$E$WG=t-[= t$=t$X v@tډD$D$$뺍&=Zt=[룉$MED$ D$D$$UEȍt$EȉD$E$zt$$LuUh}}]蝛u<$ u ]u}]É<$ut$;et$D$<$ˆUh}}]=Äu<$諌u ]u}]É<$ut$ۍMt$T$<$bUWVSEך$$:Ɛ&<$ED$D$萉! t€u<$҃)1)Uud1tSE D$ =D$D$($tE L$D$ D$f$M8[^_]É<$襅$ E D$耉$b%E D$E$ۈE $P$'UWVS u`ç4$豈1Ƀ~)<09s vF,A<v aw9r1Ƀ [^_]Í&U1}]ÐUWVS,:EEF1v49~mGF~EU‰<E;t7}0}E@;E|؋Uu;4t U1u;4uD,[^_]É}΋Dt$DT$ |$D$DD$HD$$ƄR]UWV1S 8M@@)9s׍&'@F9r [^_]ÍU$蓗ڄt$@@)puK$t$]@NuUSğğtv'ЋuX[]US[_RZ]Usage:%s: %s d:i:o:vGenerating DSA Key Pair....doneLibrary File: %s %d bytes Check File: %s Link: %s hash: %d bytes %02x signature: %d bytes SHA1 Digest CreateGenerating DSA KeyGenerating PQG ParamsCKM_DSANSS_Init failedPL_CreateOptState failed%s [-v] -i shared_library_name Digest length was not correct Unknown error string (%d)%s: : error %d wexternalEnter new password: Re-enter password: Invalid password. Failed to change password. SSL_DIR%s/%s%s%s.netscapeHOME%.900s/%s%.900s%s%.900sUnable to get key (%d) Bad password -----BEGIN-----ENDerror converting der (%s) %02x:0123456789abcdef%s [Len: %d] %s: (null) %s: %d (0x%x) TrueFalseBoolean%a %b %d %H:%M:%S %YSet Sequence %s{ } %s: [%d][%d] %s: NULL Not BeforeNot After ArgsTypeValue (%d)%s (encoded)ModulusExponentPrimeSubprimeBasePublicValuePublic Key Algorithmunknown SPKI algorithm type RSA Public KeyDSA Public KeyParsing public keyErrorPolicy Qualifier NamePolicy Qualifier DataDisplay TextPolicy Name%s: Invalid Policy DataSSL ClientSSL ServerS/MIMEObject SigningReservedSSL CAS/MIME CAObjectSigning CAIs not a CA. %c%snone Netscape Certificate Type: ServerNameCommentURLCritical!Invalid AVA!GIuPTCc(NULL),%-60s %-5s VersionSubjectSubject Public Key InfoAttributesSerial NumberSignature AlgorithmIssuerValiditySigned Extensions%s (MD5): %s (SHA1): UnknownContent Type: %s Content Encryption AlgorithmEncrypted ContentKey Encryption AlgorithmEncrypted KeyDigest AlgorithmDigest Encryption AlgorithmEncrypted DigestUnauthenticated Attributes: Attribute (%x)Authenticated Attributes: Attribute (%d)This UpdateEntry (%x): Revocation DateEntry ExtensionsCRL ExtensionsNext UpdateSigner Information List: Signer Information (%x)Signed Revocation Lists: Signed Revocation List (%x)SignatureCertificate Revocation ListCertificate List: Certificate (%x)Digest Algorithm List: Digest Algorithm (%x)Encrypted Content InformationRecipient Information List: Recipient Information (%x) Trusted Client CA User Netscape Trusted CA Valid CA Warn When Sending Trusted Valid Peer SSL Flags: Email Flags: Object Signing Flags: FingerprintPassword: Error hashing password Bad PKCS7 signatureCertificate usages is invalidIssuer certificate is invalidCertificate is not validRevoked certificateExpired Issuer CertificateU.S. only serverUnsupported versionUnsupported certificate typeNo cypher overlapNo certificateExport only serverBad serverBad clientBad certificateUntrusted issuerUntrusted certificateUnknown issuerProblem with output lengthOut of memoryLibrary failureSecurity I/O errorInvalid timeInvalid AVAInvalid argumentsInvalid algorithmProblem with input lengthInvalid extension valueExpired certificateBad signatureIncorrect passwordProblem with keyProblem with DERProblem with databaseBad dataNo error string found for %d.NSS_Initialize failed %s PROBLEM WITH THE CERT CHAIN: ERROR %ld: %s [Certificate Authority]CERT %d. %s %s: %s Email Address(es): Error opening output terminal for write Error opening input terminal for read password file contains no data No password file "%s" exists. Press Enter, then enter PIN for "%s" on external device. Password check failed: No password found. Enter Password or Pin for "%s":Incorrect password/PIN entered. Enter a password which will be used to encrypt your keys. The password should be at least 8 characters long, and should contain at least one non-alphabetic character. Passwords do not match. Try again. Invalid password. Try again. Password changed successfully. Unable to read cert (error %d) SECKEY_FindKeyByName: internal error %d Unable to get cert from database (%d) no key/cert name specified for client auth error converting ascii to binary (%s) input has header but no trailer unable to read data from input file (%d least significant bits unused) unable to format this SPKI algorithm type Extended Key Usage Extension: Is a CA with a maximum path length of %d. Certificate not approved for this operationCertificate has unknown critical extensionCertificate extension value invalidCertificate extension was not foundNo private key in database for this certCRL is older than the current one................................ !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~.................................................................................................................................544444+5555455555G5G555555c55555555EEE8EFFFFFFFFEEWEvEFDEEEEEEEEEEEEEEEEEEDEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEFffg*gFgPassword must be at least 8 characters long with one or more non-alphabetic characters Unable to communicate securely. Peer does not support high-grade encryption.Unable to communicate securely. Peer requires high-grade encryption which is not supported.Cannot communicate securely with peer: no common encryption algorithm(s).Unable to find the certificate or key necessary for authentication.Unable to communicate securely with peer: peers's certificate was rejected.The server has encountered bad data from the client.The client has encountered bad data from the server.Peer using unsupported version of security protocol.Client authentication failed: private key in key database does not match public key in certificate database.Unable to communicate securely with peer: requested domain name does not match the server's certificate.Peer only supports SSL version 2, which is locally disabled.SSL received a record with an incorrect Message Authentication Code.SSL peer reports incorrect Message Authentication Code.SSL peer cannot verify your certificate.SSL peer rejected your certificate as revoked.SSL peer rejected your certificate as expired.Cannot connect: SSL is disabled.Cannot connect: SSL peer is in another FORTEZZA domain.An unknown SSL cipher suite has been requested.No cipher suites are present and enabled in this program.SSL received a record with bad block padding.SSL received a record that exceeded the maximum permissible length.SSL attempted to send a record that exceeded the maximum permissible length.SSL received a malformed Hello Request handshake message.SSL received a malformed Client Hello handshake message.SSL received a malformed Server Hello handshake message.SSL received a malformed Certificate handshake message.SSL received a malformed Server Key Exchange handshake message.SSL received a malformed Certificate Request handshake message.SSL received a malformed Server Hello Done handshake message.SSL received a malformed Certificate Verify handshake message.SSL received a malformed Client Key Exchange handshake message.SSL received a malformed Finished handshake message.SSL received a malformed Change Cipher Spec record.SSL received a malformed Alert record.SSL received a malformed Handshake record.SSL received a malformed Application Data record.SSL received an unexpected Hello Request handshake message.SSL received an unexpected Client Hello handshake message.SSL received an unexpected Server Hello handshake message.SSL received an unexpected Certificate handshake message.SSL received an unexpected Server Key Exchange handshake message.SSL received an unexpected Certificate Request handshake message.SSL received an unexpected Server Hello Done handshake message.SSL received an unexpected Certificate Verify handshake message.SSL received an unexpected Cllient Key Exchange handshake message.SSL received an unexpected Finished handshake message.SSL received an unexpected Change Cipher Spec record.SSL received an unexpected Alert record.SSL received an unexpected Handshake record.SSL received an unexpected Application Data record.SSL received a record with an unknown content type.SSL received a handshake message with an unknown message type.SSL received an alert record with an unknown alert description.SSL peer has closed this connection.SSL peer was not expecting a handshake message it received.SSL peer was unable to succesfully decompress an SSL record it received.SSL peer was unable to negotiate an acceptable set of security parameters.SSL peer rejected a handshake message for unacceptable content.SSL peer does not support certificates of the type it received.SSL peer had some unspecified issue with the certificate it received.SSL experienced a failure of its random number generator.Unable to digitally sign data required to verify your certificate.SSL was unable to extract the public key from the peer's certificate.Unspecified failure while processing SSL Server Key Exchange handshake.Unspecified failure while processing SSL Client Key Exchange handshake.Bulk data encryption algorithm failed in selected cipher suite.Bulk data decryption algorithm failed in selected cipher suite.Attempt to write encrypted data to underlying socket failed.Failure to create Symmetric Key context.Failure to unwrap the Symmetric key in Client Key Exchange message.SSL Server attempted to use domestic-grade public key with export cipher suite.PKCS11 code failed to translate an IV into a param.Failed to initialize the selected cipher suite.Client failed to generate session keys for SSL session.Server has no key for the attempted key exchange algorithm.PKCS#11 token was inserted or removed while operation was in progress.No PKCS#11 token could be found to do a required operation.Cannot communicate securely with peer: no common compression algorithm(s).Cannot initiate another SSL handshake until current handshake is complete.Received incorrect handshakes hash values from peer.The certificate provided cannot be used with the selected key exchange algorithm.No certificate authority is trusted for SSL client authentication.Client's SSL session ID not found in server's session cache.Peer was unable to decrypt an SSL record it received.Peer received an SSL record that was longer than is permitted.Peer does not recognize and trust the CA that issued your certificate.Peer received a valid certificate, but access was denied.Peer could not decode an SSL handshake message.Peer reports failure of signature verification or key exchange.Peer reports negotiation not in compliance with export regulations.Peer reports incompatible or unsupported protocol version.Server requires ciphers more secure than those supported by client.Peer reports it experienced an internal error.Peer does not permit renegotiation of SSL security parameters.An I/O error occurred during security authorization.security library: received bad data.security library: output length error.security library has experienced an input length error.security library: invalid arguments.security library: invalid algorithm.security library: invalid AVA.Improperly formatted time string.security library: improperly formatted DER-encoded message.Peer's certificate has an invalid signature.Peer's Certificate has expired.Peer's Certificate has been revoked.Peer's Certificate issuer is not recognized.The security password entered is incorrect.New password entered incorrectly. Please try again.security library: no nodelock.security library: bad database.security library: memory allocation failure.Peer's certificate issuer has been marked as not trusted by the user.Peer's certificate has been marked as not trusted by the user.Certificate already exists in your database.Downloaded certificate's name duplicates one already in your database.Error adding certificate to database.Error refiling the key for this certificate.The private key for this certificate cannot be found in key databaseThis certificate is not valid.The certificate issuer's certificate has expired. Check your system date and time.The CRL for the certificate's issuer has expired. Update it or check your system data and time.The CRL for the certificate's issuer has an invalid signature.New CRL has an invalid format.Certificate extension value is invalid.Certificate extension not found.Issuer certificate is invalid.Certificate path length constraint is invalid.Certificate usages field is invalid.The key does not support the requested operation.Certificate contains unknown critical extension.New CRL is not later than the current one.Not encrypted or signed: you do not yet have an email certificate.Not encrypted: you do not have certificates for each of the recipients.Cannot decrypt: you are not a recipient, or matching certificate and private key not found.Cannot decrypt: key encryption algorithm does not match your certificate.Signature verification failed: no signer found, too many signers found, or improper or corrupted data.Unsupported or unknown key algorithm.Cannot decrypt: encrypted using a disallowed algorithm or key size.Fortezza card has not been properly initialized. Please remove it and return it to your issuer.Please select a personality to get more info onNo more information on that PersonalityCouldn't initialize Fortezza personalities.No KRL for this site's certificate has been found.The KRL for this site's certificate has expired.The KRL for this site's certificate has an invalid signature.The key for this site's certificate has been revoked.New KRL has an invalid format.security library: need random data.security library: no security module can perform the requested operation.The security card or token does not exist, needs to be initialized, or has been removed.security library: read-only database.No slot or token was selected.A certificate with the same nickname already exists.A key with the same nickname already exists.error while creating safe objecterror while creating baggage objectThis principal doesn't have a certificateRequired algorithm is not allowed.Error attempting to export certificates.Error attempting to import certificates.Unable to import. Decoding error. File not valid.Unable to import. Invalid MAC. Incorrect password or corrupt file.Unable to import. MAC algorithm not supported.Unable to import. Only password integrity and privacy modes supported.Unable to import. File structure is corrupt.Unable to import. Encryption algorithm not supported.Unable to import. File version not supported.Unable to import. Incorrect privacy password.Unable to import. Same nickname already exists in database.Not imported, already in database.Certificate key usage inadequate for attempted operation.Certificate type not approved for application.Address in signing certificate does not match address in message headers.Unable to import. Error attempting to import private key.Unable to import. Error attempting to import certificate chain.Unable to export. Unable to locate certificate or key by nickname.Unable to export. Private Key could not be located and exported.Unable to export. Unable to write the export file.Unable to import. Unable to read the import file.Unable to export. Key database corrupt or deleted.Unable to generate public/private key pair.Password entered is invalid. Please pick a different one.Old password entered incorrectly. Please try again.Certificate nickname already in use.Peer FORTEZZA chain has a non-FORTEZZA Certificate.A sensitive key cannot be moved to the slot where it is needed.New KRL is not later than the current one.New CKL has different issuer than current CKL. Delete current CKL.The Certifying Authority for this certificate is not permitted to issue a certificate with this name.The key revocation list for this certificate is not yet valid.The certificate revocation list for this certificate is not yet valid.The requested certificate could not be found.The signer's certificate could not be found.The location for the certificate status server has invalid format.The OCSP response cannot be fully decoded; it is of an unknown type.The OCSP server returned unexpected/invalid HTTP data.The OCSP server found the request to be corrupted or improperly formed.The OCSP server experienced an internal error.The OCSP server suggests trying again later.The OCSP server requires a signature on this request.The OCSP server has refused this request as unauthorized.The OCSP server returned an unrecognizable status.The OCSP server has no status for the certificate.You must enable OCSP before performing this operation.You must set the OCSP default responder before performing this operation.The response from the OCSP server was corrupted or improperly formed.The signer of the OCSP response is not authorized to give status for this certificate.The OCSP response is not yet valid (contains a date in the future).The OCSP response contains out-of-date information.The CMS or PKCS #7 Digest was not found in signed message.The CMS or PKCS #7 Message type is unsupported.PKCS #11 module could not be removed because it is still in use.Could not decode ASN.1 data. Specified template was invalid.You are attempting to import a cert with the same issuer/serial as an existing cert, but that is not the same cert.NSS could not shutdown. Objects are still in use.DER-encoded message contained extra usused data.Unsupported elliptic curve point form.Unrecognized Object IDentifier.Invalid OCSP signing certificate in OCSP response.Certificate is revoked in issuer's certificate revocation list.Issuer's OCSP responder reports certificate is revoked.Issuer's Certificate Revocation List has an unknown version number.Issuer's V1 Certificate Revocation List has a critical extension.Issuer's V2 Certificate Revocation List has an unknown critical extension.Unknown object type specified.PKCS #11 driver violates the spec in an incompatible way.No new slot event is available at this time.Memory allocation attempt failed.The operation would have blocked.Invalid memory address argument.Invalid function for file type.Some unknown error has occurred.Operation interrupted by another thread.I/O operation on busy file descriptor.The directory could not be opened.Network address not available (in use?).Network address type not supported.Local Network address is in use.Network address is presently unreachable.Network file descriptor is not connected.Failure to load dynamic library.Failure to unload dynamic library.Symbol not found in any of the loaded dynamic libraries.Insufficient system resources.A directory lookup on a network address has failed.Attempt to access a TPD key that is out of range.Process open FD table is full.Network operation attempted on non-network file descriptor.TCP-specific function attempted on a non-TCP file descriptor.TCP file descriptor is already bound.The requested operation is not supported by the platform.The host operating system does not support the protocol requested.Access to the remote file has been severed.The value requested is too large to be stored in the data buffer provided.The operation would have deadlocked.Write would result in file larger than the system allows.The device for storing the file is full.Cannot perform a normal file operation on a directory.Cannot perform directory operation on a normal file.Cannot write to a read-only file system.Cannot delete a directory that is not empty.Cannot delete or rename a file object while the file system is busy.Cannot rename a file to a file system on another device.The directory object in the file system is corrupted.Cannot create or rename a filename that already exists.Directory is full. No additional filenames may be added.The required device was in an invalid state.No more entries in the directory.Operation is still in progress (probably a non-blocking connect).Operation has already been initiated (probably a non-blocking connect).Object state improper for request.The socket was previously shut down.Placeholder for the end of the listsequence error in error strings at item %d error %d (%s) should come after error %d (%s) Unsupported certificate type.MD5 digest function failed.SHA-1 digest function failed.MAC computation failed.Peer user canceled handshake.security library failure.Peer's public key is invalid.This certificate is valid.Cert Library: No Response**Internal ONLY module**No Fortezza cards FoundNo Fortezza card selectedPersonality not foundInvalid PinCouldn't remove the principalCouldn't delete the privilegeThe user pressed cancel.Message not sent.Invalid module name.Invalid module path/filenameUnable to add moduleUnable to delete moduleNo matching CRL was found.Unsupported elliptic curve.Invalid file descriptor.function not implemented.I/O function error.I/O operation timed out.Invalid function argument.Already connected.Network address is invalid.Connection refused by peer.Connection attempt timed out.System open FD table is full.Access Denied.TCP connection reset by peer.Unused.The file is already locked.Symbolic link loop.File name is too long.File not found.The device is locked.Encountered end of file.Seek error.The file is busy.The wait group is empty.Network is down.TCP Connection aborted.Host is unreachable.GП/dev/tty)   ! ( 2 `22 333@44{ 4 5 56@666 7`777 8`888@999 :`:: :! ;"`;#;$;% <&`<'<(<) =*`=+=,=- >.>/>0 ?1?2?3 @4`@5@6@7 A8`A9A:A; B<`B=B> C?`C@CADB@DCDDEE`EFEGFH@FIJKLFMFN GOGPGQHR@HSHTHU IVIWIX JYJZJ[ K\`K]K^L_@L`LaLb Mc`MdMefN@N NNO@OOOO P `P P P Q#@QQQQR@RRR SSSTA`T\TT `U!U"U#V$@V%`V&V'v(V) W*`W+W,X-`X.X/ Y0Y1Y2@Z345Z67[8׀9@[:[;[<\=@\>\?\@\A@]B]C]D^E@^F^G^HIJ_K@_L_M_N`O@`P`Q`R@aSaTaUbV@bWXbY8Zb[c\@c]c^c_@d`daeb@ecedeeff@fgfhfigjJk_l|mn@gogpgq`hrhsit@iuiviw@jxjyjz k{`k|k}k~ l`llm`mm n`nnn@oop@pāppp q`qqr`rrr s`sss ts@tt'tu@@uu[nuv@vvvw@w`wwwĂx@xxxy`yyz@zzz3G^{@{{{ |`||| }n`}}~`~ԃ~~y "-  pH ؟@șxoȘoo&6FVfvƞ֞&6FVfvƟ֟&6FVfvƠ֠&6FVfvơ֡&6FVfvƢ֢&6FVfvƣ֣&6FVfvƤ֤&6FVfvGCC: (GNU) 3.3.5 (Debian 1:3.3.5-1)GCC: (GNU) 3.3.5 (Debian 1:3.3.5-1)GCC: (GNU) 3.3.5 (Debian 1:3.3.5-3)GCC: (GNU) 3.3.5 (Debian 1:3.3.5-3)GCC: (GNU) 3.3.5 (Debian 1:3.3.5-3)GCC: (GNU) 3.3.5 (Debian 1:3.3.5-3)GCC: (GNU) 3.3.5 (Debian 1:3.3.5-3)GCC: (GNU) 3.3.5 (Debian 1:3.3.5-1)GCC: (GNU) 3.3.5 (Debian 1:3.3.5-3)GCC: (GNU) 3.3.5 (Debian 1:3.3.5-1).shstrtab.interp.note.ABI-tag.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.dyn.rel.plt.init.text.fini.rodata.data.eh_frame.dynamic.ctors.dtors.jcr.got.bss.comment (( !HHT'  / 7o DoȘS șx\ @@ e`k%uqppwxh    ğ̟ԟ؟$ rr