PK(€q4­ðÖuticketdelete/__init__.pyfrom web_ui import * PKÝ„68øßÖ¦¦ticketdelete/__init__.pyo;ò œ#Dc@s dkTdS((s*N(sweb_ui(((s9build/bdist.darwin-8.0.1-x86/egg/ticketdelete/__init__.pys?sPKØ„68¸ã^@Ó)Ó)ticketdelete/web_ui.pyc;ò ÙWEc@s²dklZdkTdklZdklZdkl Z l Z l Z dk l Z dklZdkZdkZdkZdklZlZd gZd efd „ƒYZdS( (s __version__(s*(sTicket(sIRequestFilter(sITemplateProviders add_scriptsadd_stylesheet(ssorted(sIAdminPageProviderN(sstrftimes localtimesTicketDeletePlugincBs{tZdZeeeeƒd„Zd„Zd„Z d„Z d„Z d„Z d„Z d„Zd „Zed „ZRS( sA small ticket deletion plugin.cCs|SdS(N(shandler(sselfsreqshandler((s7build/bdist.darwin-8.0.1-x86/egg/ticketdelete/web_ui.pyspre_process_requestscCsY|djo|iidƒo+t|dƒt|dƒt|dƒn||fSdS(Ns ticket.css TICKET_ADMINsticketdelete/jquery.jssticketdelete/ticketdelete.jssticketdelete/ticketdelete.css(stemplatesreqspermshas_permissions add_scriptsadd_stylesheets content_type(sselfsreqstemplates content_type((s7build/bdist.darwin-8.0.1-x86/egg/ticketdelete/web_ui.pyspost_process_requests    ccs;|iidƒo$ddddfVddddfVndS(Ns TICKET_ADMINstickets Ticket SystemsdeletesDeletescommentssDelete Changes(sreqspermshas_permission(sselfsreq((s7build/bdist.darwin-8.0.1-x86/egg/ticketdelete/web_ui.pysget_admin_pages#scCsj|iidƒpt‚|iid||ƒ|i d<||i d|i)ƒD]0\}}d"|i dhƒjo ||=q‡q‡Wt7t8|i9ƒƒƒ}|tj o|t;|ƒjot<|||d#Esiis5TicketDelete: Deleting change to ticket %s at %s (%s)s,Change to ticket #%s at %s has been modifieds%a, %d %b %Y %H:%M:%SsTicketDelete: Error is %ssTicketDelete: args = '%s'sTimestamp '%s' not validstsscnumsoldsnewsfieldssauthors prettytimes attachmentscheckedsticketdelete.changes.sticketdelete.idsticketdelete_admin.cs(=sreqspermshas_permissionsAssertionErrorsselfsenvshrefscatspageshdfsmethodsargssgets _validatests_delete_ticketsidsredirectsadmins path_infosNones deletionssappends_[1]sgetlistsxssplitssortskeyss startswithsbuttonssfieldstssintslogsdebugs_delete_changesstrftimes localtimes ValueErrorsesitemssselecteds TypeErrors ticket_datas get_changelogstimesauthorsoldvaluesnewvalues setdefaultsstrsdatasksvslistssortedsiterkeyss time_listslensTrue(sselfsreqscatspages path_infosoldvalues time_listsauthorsselectedstsspermsbuttonssfields deletionssvs ticket_datasdatasesnewvaluesks_[1]ststimesx((s7build/bdist.darwin-8.0.1-x86/egg/ticketdelete/web_ui.pysprocess_admin_request(s„    % 2"<H   ).    (    cCs!dkl}|tdƒgSdS(sr Return the absolute path of the directory containing the provided ClearSilver templates. (sresource_filenames templatesN(s pkg_resourcessresource_filenames__name__(sselfsresource_filename((s7build/bdist.darwin-8.0.1-x86/egg/ticketdelete/web_ui.pysget_templates_dirsxs cCs'dkl}d|tdƒfgSdS(s§ Return a list of directories with static resources (such as style sheets, images, etc.) Each item in the list must be a `(prefix, abspath)` tuple. The `prefix` part defines the path in the URL that requests to these resources are prefixed with. The `abspath` is the absolute path to the directory containing the resources on the local file system. (sresource_filenames ticketdeleteshtdocsN(s pkg_resourcessresource_filenames__name__(sselfsresource_filename((s7build/bdist.darwin-8.0.1-x86/egg/ticketdelete/web_ui.pysget_htdocs_dirs€s  cCsStidtƒ}|o,t|idƒƒt|idƒƒfSn ddfSdS(Ns (\d+)\.(\d+)iii(sresmatchs TRAC_VERSIONsmdsintsgroup(sselfsmd((s7build/bdist.darwin-8.0.1-x86/egg/ticketdelete/web_ui.pys_get_trac_versions,cCsxy&t|ƒ}t|i|ƒ}|SWnGtj od||i d|i&ƒD]0\}}d!|i dhƒjo ||=qmqmWt5t6|i7ƒƒƒ}|tj o|t9|ƒjot:|||d"|djo|i |id$qBnd%tfSdS(&Nsadminsticketdelete.hrefsticketdelete.pageisticketdelete.redirsPOSTsdeletesticketids ticketid2sTicket #%s has been deleted.sticketdelete.messages,The two IDs did not match. Please try again.scommentss multideletesmdeletes_cCst|d|dƒS(Ni(scmpsbsa(sasb((s7build/bdist.darwin-8.0.1-x86/egg/ticketdelete/web_ui.pysEsiis5TicketDelete: Deleting change to ticket %s at %s (%s)s,Change to ticket #%s at %s has been modifieds%a, %d %b %Y %H:%M:%SsTicketDelete: Error is %ssTicketDelete: args = '%s'sTimestamp '%s' not validstsscnumsoldsnewsfieldssauthors prettytimes attachmentscheckedsticketdelete.changes.sticketdelete.idsticketdelete_admin.cs(;sselfsenvshrefscatspagesreqshdfsmethodsargssgets _validatests_delete_ticketsidsredirectsadmins path_infosNones deletionssappends_[1]sgetlistsxssplitssortskeyss startswithsbuttonssfieldstssintslogsdebugs_delete_changesstrftimes localtimes ValueErrorsesitemssselecteds TypeErrors ticket_datas get_changelogstimesauthorsoldvaluesnewvaluesperms setdefaultsstrsdatasksvslistssortedsiterkeyss time_listslensTrue(sselfsreqscatspages path_infosoldvalues time_listsauthorsselectedstsspermsbuttonssfields deletionssvs ticket_datasdatasesnewvaluesks_[1]ststimesx((s7build/bdist.darwin-8.0.1-x86/egg/ticketdelete/web_ui.pysprocess_admin_request(s„    % 2"<H   ).    (    cCs!dkl}|tdƒgSdS(sr Return the absolute path of the directory containing the provided ClearSilver templates. (sresource_filenames templatesN(s pkg_resourcessresource_filenames__name__(sselfsresource_filename((s7build/bdist.darwin-8.0.1-x86/egg/ticketdelete/web_ui.pysget_templates_dirsxs cCs'dkl}d|tdƒfgSdS(s§ Return a list of directories with static resources (such as style sheets, images, etc.) Each item in the list must be a `(prefix, abspath)` tuple. The `prefix` part defines the path in the URL that requests to these resources are prefixed with. The `abspath` is the absolute path to the directory containing the resources on the local file system. (sresource_filenames ticketdeleteshtdocsN(s pkg_resourcessresource_filenames__name__(sselfsresource_filename((s7build/bdist.darwin-8.0.1-x86/egg/ticketdelete/web_ui.pysget_htdocs_dirs€s  cCsStidtƒ}|o,t|idƒƒt|idƒƒfSn ddfSdS(Ns (\d+)\.(\d+)iii(sresmatchs TRAC_VERSIONsmdsintsgroup(sselfsmd((s7build/bdist.darwin-8.0.1-x86/egg/ticketdelete/web_ui.pys_get_trac_versions,cCsxy&t|ƒ}t|i|ƒ}|SWnGtj od||i d 0 or minor >= 10: ticket = Ticket(self.env,id) ticket.delete() else: db = self.env.get_db_cnx() cursor = db.cursor() cursor.execute("DELETE FROM ticket WHERE id=%s", (id,)) cursor.execute("DELETE FROM ticket_change WHERE ticket=%s", (id,)) cursor.execute("DELETE FROM attachment WHERE type='ticket' and id=%s", (id,)) cursor.execute("DELETE FROM ticket_custom WHERE ticket=%s", (id,)) db.commit() def _delete_change(self, id, ts, field=None): """Delete the change on the given ticket at the given timestamp.""" db = self.env.get_db_cnx() cursor = db.cursor() ticket = Ticket(self.env,id) if field: if field == 'attachment': pass # Better handling still pending else: custom_fields = [f['name'] for f in ticket.fields if f.get('custom')] if field != "comment" and not [1 for time, author, field2, oldval, newval, _ in ticket.get_changelog() if time > ts and field == field2]: oldval = [old for _, _, field2, old, _, _ in ticket.get_changelog(ts) if field2 == field][0] if field in custom_fields: cursor.execute("UPDATE ticket_custom SET value=%s WHERE ticket=%s AND name=%s", (oldval, id, field)) else: cursor.execute("UPDATE ticket SET %s=%%s WHERE id=%%s" % field, (oldval, id)) cursor.execute("DELETE FROM ticket_change WHERE ticket = %s AND time = %s AND field = %s", (id, ts, field)) else: for _, _, field, _, _, _ in ticket.get_changelog(ts): self._delete_change(id, ts, field) db.commit() PKn 05.­>Ò²Ò²ticketdelete/htdocs/jquery.js/* * jQuery - New Wave Javascript * * Copyright (c) 2006 John Resig (jquery.com) * Dual licensed under the MIT (MIT-LICENSE.txt) * and GPL (GPL-LICENSE.txt) licenses. * * $Date: 2006-08-31 13:26:31 -0400 (Thu, 31 Aug 2006) $ * $Rev: 249 $ */ // Global undefined variable window.undefined = window.undefined; function jQuery(a,c) { // Shortcut for document ready (because $(document).each() is silly) if ( a && a.constructor == Function && jQuery.fn.ready ) return jQuery(document).ready(a); // Make sure that a selection was provided a = a || jQuery.context || document; // Watch for when a jQuery object is passed as the selector if ( a.jquery ) return $( jQuery.merge( a, [] ) ); // Watch for when a jQuery object is passed at the context if ( c && c.jquery ) return $( c ).find(a); // If the context is global, return a new object if ( window == this ) return new jQuery(a,c); // Handle HTML strings var m = /^[^<]*(<.+>)[^>]*$/.exec(a); if ( m ) a = jQuery.clean( [ m[1] ] ); // Watch for when an array is passed in this.get( a.constructor == Array || a.length && !a.nodeType && a[0] != undefined && a[0].nodeType ? // Assume that it is an array of DOM Elements jQuery.merge( a, [] ) : // Find the matching elements and save them for later jQuery.find( a, c ) ); // See if an extra function was provided var fn = arguments[ arguments.length - 1 ]; // If so, execute it in context if ( fn && fn.constructor == Function ) this.each(fn); } // Map over the $ in case of overwrite if ( typeof $ != "undefined" ) jQuery._$ = $; // Map the jQuery namespace to the '$' one var $ = jQuery; jQuery.fn = jQuery.prototype = { jquery: "$Rev: 249 $", size: function() { return this.length; }, get: function( num ) { // Watch for when an array (of elements) is passed in if ( num && num.constructor == Array ) { // Use a tricky hack to make the jQuery object // look and feel like an array this.length = 0; [].push.apply( this, num ); return this; } else return num == undefined ? // Return a 'clean' array jQuery.map( this, function(a){ return a } ) : // Return just the object this[num]; }, each: function( fn, args ) { return jQuery.each( this, fn, args ); }, index: function( obj ) { var pos = -1; this.each(function(i){ if ( this == obj ) pos = i; }); return pos; }, attr: function( key, value, type ) { // Check to see if we're setting style values return key.constructor != String || value != undefined ? this.each(function(){ // See if we're setting a hash of styles if ( value == undefined ) // Set all the styles for ( var prop in key ) jQuery.attr( type ? this.style : this, prop, key[prop] ); // See if we're setting a single key/value style else jQuery.attr( type ? this.style : this, key, value ); }) : // Look for the case where we're accessing a style value jQuery[ type || "attr" ]( this[0], key ); }, css: function( key, value ) { return this.attr( key, value, "curCSS" ); }, text: function(e) { e = e || this; var t = ""; for ( var j = 0; j < e.length; j++ ) { var r = e[j].childNodes; for ( var i = 0; i < r.length; i++ ) if ( r[i].nodeType != 8 ) t += r[i].nodeType != 1 ? r[i].nodeValue : jQuery.fn.text([ r[i] ]); } return t; }, wrap: function() { // The elements to wrap the target around var a = jQuery.clean(arguments); // Wrap each of the matched elements individually return this.each(function(){ // Clone the structure that we're using to wrap var b = a[0].cloneNode(true); // Insert it before the element to be wrapped this.parentNode.insertBefore( b, this ); // Find he deepest point in the wrap structure while ( b.firstChild ) b = b.firstChild; // Move the matched element to within the wrap structure b.appendChild( this ); }); }, append: function() { return this.domManip(arguments, true, 1, function(a){ this.appendChild( a ); }); }, prepend: function() { return this.domManip(arguments, true, -1, function(a){ this.insertBefore( a, this.firstChild ); }); }, before: function() { return this.domManip(arguments, false, 1, function(a){ this.parentNode.insertBefore( a, this ); }); }, after: function() { return this.domManip(arguments, false, -1, function(a){ this.parentNode.insertBefore( a, this.nextSibling ); }); }, end: function() { return this.get( this.stack.pop() ); }, find: function(t) { return this.pushStack( jQuery.map( this, function(a){ return jQuery.find(t,a); }), arguments ); }, clone: function(deep) { return this.pushStack( jQuery.map( this, function(a){ return a.cloneNode( deep != undefined ? deep : true ); }), arguments ); }, filter: function(t) { return this.pushStack( t.constructor == Array && jQuery.map(this,function(a){ for ( var i = 0; i < t.length; i++ ) if ( jQuery.filter(t[i],[a]).r.length ) return a; }) || t.constructor == Boolean && ( t ? this.get() : [] ) || t.constructor == Function && jQuery.grep( this, t ) || jQuery.filter(t,this).r, arguments ); }, not: function(t) { return this.pushStack( t.constructor == String ? jQuery.filter(t,this,false).r : jQuery.grep(this,function(a){ return a != t; }), arguments ); }, add: function(t) { return this.pushStack( jQuery.merge( this, t.constructor == String ? jQuery.find(t) : t.constructor == Array ? t : [t] ), arguments ); }, is: function(expr) { return expr ? jQuery.filter(expr,this).r.length > 0 : this.length > 0; }, domManip: function(args, table, dir, fn){ var clone = this.size() > 1; var a = jQuery.clean(args); return this.each(function(){ var obj = this; if ( table && this.nodeName == "TABLE" && a[0].nodeName != "THEAD" ) { var tbody = this.getElementsByTagName("tbody"); if ( !tbody.length ) { obj = document.createElement("tbody"); this.appendChild( obj ); } else obj = tbody[0]; } for ( var i = ( dir < 0 ? a.length - 1 : 0 ); i != ( dir < 0 ? dir : a.length ); i += dir ) { fn.apply( obj, [ clone ? a[i].cloneNode(true) : a[i] ] ); } }); }, pushStack: function(a,args) { var fn = args && args[args.length-1]; if ( !fn || fn.constructor != Function ) { if ( !this.stack ) this.stack = []; this.stack.push( this.get() ); this.get( a ); } else { var old = this.get(); this.get( a ); if ( fn.constructor == Function ) return this.each( fn ); this.get( old ); } return this; } }; jQuery.extend = jQuery.fn.extend = function(obj,prop) { if ( !prop ) { prop = obj; obj = this; } for ( var i in prop ) obj[i] = prop[i]; return obj; }; jQuery.extend({ init: function(){ jQuery.initDone = true; jQuery.each( jQuery.macros.axis, function(i,n){ jQuery.fn[ i ] = function(a) { var ret = jQuery.map(this,n); if ( a && a.constructor == String ) ret = jQuery.filter(a,ret).r; return this.pushStack( ret, arguments ); }; }); jQuery.each( jQuery.macros.to, function(i,n){ jQuery.fn[ i ] = function(){ var a = arguments; return this.each(function(){ for ( var j = 0; j < a.length; j++ ) $(a[j])[n]( this ); }); }; }); jQuery.each( jQuery.macros.each, function(i,n){ jQuery.fn[ i ] = function() { return this.each( n, arguments ); }; }); jQuery.each( jQuery.macros.filter, function(i,n){ jQuery.fn[ n ] = function(num,fn) { return this.filter( ":" + n + "(" + num + ")", fn ); }; }); jQuery.each( jQuery.macros.attr, function(i,n){ n = n || i; jQuery.fn[ i ] = function(h) { return h == undefined ? this.length ? this[0][n] : null : this.attr( n, h ); }; }); jQuery.each( jQuery.macros.css, function(i,n){ jQuery.fn[ n ] = function(h) { return h == undefined ? ( this.length ? jQuery.css( this[0], n ) : null ) : this.css( n, h ); }; }); }, each: function( obj, fn, args ) { if ( obj.length == undefined ) for ( var i in obj ) fn.apply( obj[i], args || [i, obj[i]] ); else for ( var i = 0; i < obj.length; i++ ) fn.apply( obj[i], args || [i, obj[i]] ); return obj; }, className: { add: function(o,c){ if (jQuery.className.has(o,c)) return; o.className += ( o.className ? " " : "" ) + c; }, remove: function(o,c){ o.className = !c ? "" : o.className.replace( new RegExp("(^|\\s*\\b[^-])"+c+"($|\\b(?=[^-]))", "g"), ""); }, has: function(e,a) { if ( e.className != undefined ) e = e.className; return new RegExp("(^|\\s)" + a + "(\\s|$)").test(e); } }, swap: function(e,o,f) { for ( var i in o ) { e.style["old"+i] = e.style[i]; e.style[i] = o[i]; } f.apply( e, [] ); for ( var i in o ) e.style[i] = e.style["old"+i]; }, css: function(e,p) { if ( p == "height" || p == "width" ) { var old = {}, oHeight, oWidth, d = ["Top","Bottom","Right","Left"]; for ( var i in d ) { old["padding" + d[i]] = 0; old["border" + d[i] + "Width"] = 0; } jQuery.swap( e, old, function() { if (jQuery.css(e,"display") != "none") { oHeight = e.offsetHeight; oWidth = e.offsetWidth; } else { e = $(e.cloneNode(true)).css({ visibility: "hidden", position: "absolute", display: "block" }).prependTo("body")[0]; oHeight = e.clientHeight; oWidth = e.clientWidth; e.parentNode.removeChild(e); } }); return p == "height" ? oHeight : oWidth; } else if ( p == "opacity" && jQuery.browser.msie ) return parseFloat( jQuery.curCSS(e,"filter").replace(/[^0-9.]/,"") ) || 1; return jQuery.curCSS( e, p ); }, curCSS: function(elem, prop, force) { var ret; if (!force && elem.style[prop]) { ret = elem.style[prop]; } else if (elem.currentStyle) { var newProp = prop.replace(/\-(\w)/g,function(m,c){return c.toUpperCase()}); ret = elem.currentStyle[prop] || elem.currentStyle[newProp]; } else if (document.defaultView && document.defaultView.getComputedStyle) { prop = prop.replace(/([A-Z])/g,"-$1").toLowerCase(); var cur = document.defaultView.getComputedStyle(elem, null); if ( cur ) ret = cur.getPropertyValue(prop); else if ( prop == 'display' ) ret = 'none'; else jQuery.swap(elem, { display: 'block' }, function() { ret = document.defaultView.getComputedStyle(this,null).getPropertyValue(prop); }); } return ret; }, clean: function(a) { var r = []; for ( var i = 0; i < a.length; i++ ) { if ( a[i].constructor == String ) { var table = ""; if ( !a[i].indexOf(""; } else if ( !a[i].indexOf(""; } else if ( !a[i].indexOf(""; } var div = document.createElement("div"); div.innerHTML = a[i]; if ( table ) { div = div.firstChild; if ( table != "thead" ) div = div.firstChild; if ( table == "td" ) div = div.firstChild; } for ( var j = 0; j < div.childNodes.length; j++ ) r.push( div.childNodes[j] ); } else if ( a[i].jquery || a[i].length && !a[i].nodeType ) for ( var k = 0; k < a[i].length; k++ ) r.push( a[i][k] ); else if ( a[i] !== null ) r.push( a[i].nodeType ? a[i] : document.createTextNode(a[i].toString()) ); } return r; }, expr: { "": "m[2]== '*'||a.nodeName.toUpperCase()==m[2].toUpperCase()", "#": "a.getAttribute('id')&&a.getAttribute('id')==m[2]", ":": { // Position Checks lt: "im[3]-0", nth: "m[3]-0==i", eq: "m[3]-0==i", first: "i==0", last: "i==r.length-1", even: "i%2==0", odd: "i%2", // Child Checks "nth-child": "jQuery.sibling(a,m[3]).cur", "first-child": "jQuery.sibling(a,0).cur", "last-child": "jQuery.sibling(a,0).last", "only-child": "jQuery.sibling(a).length==1", // Parent Checks parent: "a.childNodes.length", empty: "!a.childNodes.length", // Text Check contains: "(a.innerText||a.innerHTML).indexOf(m[3])>=0", // Visibility visible: "a.type!='hidden'&&jQuery.css(a,'display')!='none'&&jQuery.css(a,'visibility')!='hidden'", hidden: "a.type=='hidden'||jQuery.css(a,'display')=='none'||jQuery.css(a,'visibility')=='hidden'", // Form elements enabled: "!a.disabled", disabled: "a.disabled", checked: "a.checked", selected: "a.selected" }, ".": "jQuery.className.has(a,m[2])", "@": { "=": "z==m[4]", "!=": "z!=m[4]", "^=": "!z.indexOf(m[4])", "$=": "z.substr(z.length - m[4].length,m[4].length)==m[4]", "*=": "z.indexOf(m[4])>=0", "": "z" }, "[": "jQuery.find(m[2],a).length" }, token: [ "\\.\\.|/\\.\\.", "a.parentNode", ">|/", "jQuery.sibling(a.firstChild)", "\\+", "jQuery.sibling(a).next", "~", function(a){ var r = []; var s = jQuery.sibling(a); if ( s.n > 0 ) for ( var i = s.n; i < s.length; i++ ) r.push( s[i] ); return r; } ], find: function( t, context ) { // Make sure that the context is a DOM Element if ( context && context.nodeType == undefined ) context = null; // Set the correct context (if none is provided) context = context || jQuery.context || document; if ( t.constructor != String ) return [t]; if ( !t.indexOf("//") ) { context = context.documentElement; t = t.substr(2,t.length); } else if ( !t.indexOf("/") ) { context = context.documentElement; t = t.substr(1,t.length); // FIX Assume the root element is right :( if ( t.indexOf("/") >= 1 ) t = t.substr(t.indexOf("/"),t.length); } var ret = [context]; var done = []; var last = null; while ( t.length > 0 && last != t ) { var r = []; last = t; t = jQuery.trim(t).replace( /^\/\//i, "" ); var foundToken = false; for ( var i = 0; i < jQuery.token.length; i += 2 ) { if ( foundToken ) continue; var re = new RegExp("^(" + jQuery.token[i] + ")"); var m = re.exec(t); if ( m ) { r = ret = jQuery.map( ret, jQuery.token[i+1] ); t = jQuery.trim( t.replace( re, "" ) ); foundToken = true; } } if ( !foundToken ) { if ( !t.indexOf(",") || !t.indexOf("|") ) { if ( ret[0] == context ) ret.shift(); done = jQuery.merge( done, ret ); r = ret = [context]; t = " " + t.substr(1,t.length); } else { var re2 = /^([#.]?)([a-z0-9\\*_-]*)/i; var m = re2.exec(t); if ( m[1] == "#" ) { // Ummm, should make this work in all XML docs var oid = document.getElementById(m[2]); r = ret = oid ? [oid] : []; t = t.replace( re2, "" ); } else { if ( !m[2] || m[1] == "." ) m[2] = "*"; for ( var i = 0; i < ret.length; i++ ) r = jQuery.merge( r, m[2] == "*" ? jQuery.getAll(ret[i]) : ret[i].getElementsByTagName(m[2]) ); } } } if ( t ) { var val = jQuery.filter(t,r); ret = r = val.r; t = jQuery.trim(val.t); } } if ( ret && ret[0] == context ) ret.shift(); done = jQuery.merge( done, ret ); return done; }, getAll: function(o,r) { r = r || []; var s = o.childNodes; for ( var i = 0; i < s.length; i++ ) if ( s[i].nodeType == 1 ) { r.push( s[i] ); jQuery.getAll( s[i], r ); } return r; }, attr: function(elem, name, value){ var fix = { "for": "htmlFor", "class": "className", "float": "cssFloat", innerHTML: "innerHTML", className: "className", value: "value", disabled: "disabled" }; if ( fix[name] ) { if ( value != undefined ) elem[fix[name]] = value; return elem[fix[name]]; } else if ( elem.getAttribute ) { if ( value != undefined ) elem.setAttribute( name, value ); return elem.getAttribute( name, 2 ); } else { name = name.replace(/-([a-z])/ig,function(z,b){return b.toUpperCase();}); if ( value != undefined ) elem[name] = value; return elem[name]; } }, // The regular expressions that power the parsing engine parse: [ // Match: [@value='test'], [@foo] [ "\\[ *(@)S *([!*$^=]*) *Q\\]", 1 ], // Match: [div], [div p] [ "(\\[)Q\\]", 0 ], // Match: :contains('foo') [ "(:)S\\(Q\\)", 0 ], // Match: :even, :last-chlid [ "([:.#]*)S", 0 ] ], filter: function(t,r,not) { // Figure out if we're doing regular, or inverse, filtering var g = not !== false ? jQuery.grep : function(a,f) {return jQuery.grep(a,f,true);}; while ( t && /^[a-z[({<*:.#]/i.test(t) ) { var p = jQuery.parse; for ( var i = 0; i < p.length; i++ ) { var re = new RegExp( "^" + p[i][0] // Look for a string-like sequence .replace( 'S', "([a-z*_-][a-z0-9_-]*)" ) // Look for something (optionally) enclosed with quotes .replace( 'Q', " *'?\"?([^'\"]*?)'?\"? *" ), "i" ); var m = re.exec( t ); if ( m ) { // Re-organize the match if ( p[i][1] ) m = ["", m[1], m[3], m[2], m[4]]; // Remove what we just matched t = t.replace( re, "" ); break; } } // :not() is a special case that can be optomized by // keeping it out of the expression list if ( m[1] == ":" && m[2] == "not" ) r = jQuery.filter(m[3],r,false).r; // Otherwise, find the expression to execute else { var f = jQuery.expr[m[1]]; if ( f.constructor != String ) f = jQuery.expr[m[1]][m[2]]; // Build a custom macro to enclose it eval("f = function(a,i){" + ( m[1] == "@" ? "z=jQuery.attr(a,m[3]);" : "" ) + "return " + f + "}"); // Execute it against the current filter r = g( r, f ); } } // Return an array of filtered elements (r) // and the modified expression string (t) return { r: r, t: t }; }, trim: function(t){ return t.replace(/^\s+|\s+$/g, ""); }, parents: function( elem ){ var matched = []; var cur = elem.parentNode; while ( cur && cur != document ) { matched.push( cur ); cur = cur.parentNode; } return matched; }, sibling: function(elem, pos, not) { var elems = []; var siblings = elem.parentNode.childNodes; for ( var i = 0; i < siblings.length; i++ ) { if ( not === true && siblings[i] == elem ) continue; if ( siblings[i].nodeType == 1 ) elems.push( siblings[i] ); if ( siblings[i] == elem ) elems.n = elems.length - 1; } return jQuery.extend( elems, { last: elems.n == elems.length - 1, cur: pos == "even" && elems.n % 2 == 0 || pos == "odd" && elems.n % 2 || elems[pos] == elem, prev: elems[elems.n - 1], next: elems[elems.n + 1] }); }, merge: function(first, second) { var result = []; // Move b over to the new array (this helps to avoid // StaticNodeList instances) for ( var k = 0; k < first.length; k++ ) result[k] = first[k]; // Now check for duplicates between a and b and only // add the unique items for ( var i = 0; i < second.length; i++ ) { var noCollision = true; // The collision-checking process for ( var j = 0; j < first.length; j++ ) if ( second[i] == first[j] ) noCollision = false; // If the item is unique, add it if ( noCollision ) result.push( second[i] ); } return result; }, grep: function(elems, fn, inv) { // If a string is passed in for the function, make a function // for it (a handy shortcut) if ( fn.constructor == String ) fn = new Function("a","i","return " + fn); var result = []; // Go through the array, only saving the items // that pass the validator function for ( var i = 0; i < elems.length; i++ ) if ( !inv && fn(elems[i],i) || inv && !fn(elems[i],i) ) result.push( elems[i] ); return result; }, map: function(elems, fn) { // If a string is passed in for the function, make a function // for it (a handy shortcut) if ( fn.constructor == String ) fn = new Function("a","return " + fn); var result = []; // Go through the array, translating each of the items to their // new value (or values). for ( var i = 0; i < elems.length; i++ ) { var val = fn(elems[i],i); if ( val !== null && val != undefined ) { if ( val.constructor != Array ) val = [val]; result = jQuery.merge( result, val ); } } return result; }, /* * A number of helper functions used for managing events. * Many of the ideas behind this code orignated from Dean Edwards' addEvent library. */ event: { // Bind an event to an element // Original by Dean Edwards add: function(element, type, handler) { // For whatever reason, IE has trouble passing the window object // around, causing it to be cloned in the process if ( jQuery.browser.msie && element.setInterval != undefined ) element = window; // Make sure that the function being executed has a unique ID if ( !handler.guid ) handler.guid = this.guid++; // Init the element's event structure if (!element.events) element.events = {}; // Get the current list of functions bound to this event var handlers = element.events[type]; // If it hasn't been initialized yet if (!handlers) { // Init the event handler queue handlers = element.events[type] = {}; // Remember an existing handler, if it's already there if (element["on" + type]) handlers[0] = element["on" + type]; } // Add the function to the element's handler list handlers[handler.guid] = handler; // And bind the global event handler to the element element["on" + type] = this.handle; // Remember the function in a global list (for triggering) if (!this.global[type]) this.global[type] = []; this.global[type].push( element ); }, guid: 1, global: {}, // Detach an event or set of events from an element remove: function(element, type, handler) { if (element.events) if (type && element.events[type]) if ( handler ) delete element.events[type][handler.guid]; else for ( var i in element.events[type] ) delete element.events[type][i]; else for ( var j in element.events ) this.remove( element, j ); }, trigger: function(type,data,element) { // Touch up the incoming data data = data || []; // Handle a global trigger if ( !element ) { var g = this.global[type]; if ( g ) for ( var i = 0; i < g.length; i++ ) this.trigger( type, data, g[i] ); // Handle triggering a single element } else if ( element["on" + type] ) { // Pass along a fake event data.unshift( this.fix({ type: type, target: element }) ); // Trigger the event element["on" + type].apply( element, data ); } }, handle: function(event) { if ( typeof jQuery == "undefined" ) return; event = event || jQuery.event.fix( window.event ); // If no correct event was found, fail if ( !event ) return; var returnValue = true; var c = this.events[event.type]; for ( var j in c ) { if ( c[j].apply( this, [event] ) === false ) { event.preventDefault(); event.stopPropagation(); returnValue = false; } } return returnValue; }, fix: function(event) { if ( event ) { event.preventDefault = function() { this.returnValue = false; }; event.stopPropagation = function() { this.cancelBubble = true; }; } return event; } } }); new function() { var b = navigator.userAgent.toLowerCase(); // Figure out what browser is being used jQuery.browser = { safari: /webkit/.test(b), opera: /opera/.test(b), msie: /msie/.test(b) && !/opera/.test(b), mozilla: /mozilla/.test(b) && !/compatible/.test(b) }; // Check to see if the W3C box model is being used jQuery.boxModel = !jQuery.browser.msie || document.compatMode == "CSS1Compat"; }; jQuery.macros = { to: { appendTo: "append", prependTo: "prepend", insertBefore: "before", insertAfter: "after" }, css: "width,height,top,left,position,float,overflow,color,background".split(","), filter: [ "eq", "lt", "gt", "contains" ], attr: { val: "value", html: "innerHTML", id: null, title: null, name: null, href: null, src: null, rel: null }, axis: { parent: "a.parentNode", ancestors: jQuery.parents, parents: jQuery.parents, next: "jQuery.sibling(a).next", prev: "jQuery.sibling(a).prev", siblings: jQuery.sibling, children: "jQuery.sibling(a.firstChild)" }, each: { removeAttr: function( key ) { this.removeAttribute( key ); }, show: function(){ this.style.display = this.oldblock ? this.oldblock : ""; if ( jQuery.css(this,"display") == "none" ) this.style.display = "block"; }, hide: function(){ this.oldblock = this.oldblock || jQuery.css(this,"display"); if ( this.oldblock == "none" ) this.oldblock = "block"; this.style.display = "none"; }, toggle: function(){ $(this)[ $(this).is(":hidden") ? "show" : "hide" ].apply( $(this), arguments ); }, addClass: function(c){ jQuery.className.add(this,c); }, removeClass: function(c){ jQuery.className.remove(this,c); }, toggleClass: function( c ){ jQuery.className[ jQuery.className.has(this,c) ? "remove" : "add" ](this,c); }, remove: function(a){ if ( !a || jQuery.filter( a, [this] ).r ) this.parentNode.removeChild( this ); }, empty: function(){ while ( this.firstChild ) this.removeChild( this.firstChild ); }, bind: function( type, fn ) { if ( fn.constructor == String ) fn = new Function("e", ( !fn.indexOf(".") ? "$(this)" : "return " ) + fn); jQuery.event.add( this, type, fn ); }, unbind: function( type, fn ) { jQuery.event.remove( this, type, fn ); }, trigger: function( type, data ) { jQuery.event.trigger( type, data, this ); } } }; jQuery.init(); jQuery.fn.extend({ // We're overriding the old toggle function, so // remember it for later _toggle: jQuery.fn.toggle, toggle: function(a,b) { // If two functions are passed in, we're // toggling on a click return a && b && a.constructor == Function && b.constructor == Function ? this.click(function(e){ // Figure out which function to execute this.last = this.last == a ? b : a; // Make sure that clicks stop e.preventDefault(); // and execute the function return this.last.apply( this, [e] ) || false; }) : // Otherwise, execute the old toggle function this._toggle.apply( this, arguments ); }, hover: function(f,g) { // A private function for haandling mouse 'hovering' function handleHover(e) { // Check if mouse(over|out) are still within the same parent element var p = (e.type == "mouseover" ? e.fromElement : e.toElement) || e.relatedTarget; // Traverse up the tree while ( p && p != this ) p = p.parentNode; // If we actually just moused on to a sub-element, ignore it if ( p == this ) return false; // Execute the right function return (e.type == "mouseover" ? f : g).apply(this, [e]); } // Bind the function to the two event listeners return this.mouseover(handleHover).mouseout(handleHover); }, ready: function(f) { // If the DOM is already ready if ( jQuery.isReady ) // Execute the function immediately f.apply( document ); // Otherwise, remember the function for later else { // Add the function to the wait list jQuery.readyList.push( f ); } return this; } }); jQuery.extend({ /* * All the code that makes DOM Ready work nicely. */ isReady: false, readyList: [], // Handle when the DOM is ready ready: function() { // Make sure that the DOM is not already loaded if ( !jQuery.isReady ) { // Remember that the DOM is ready jQuery.isReady = true; // If there are functions bound, to execute if ( jQuery.readyList ) { // Execute all of them for ( var i = 0; i < jQuery.readyList.length; i++ ) jQuery.readyList[i].apply( document ); // Reset the list of functions jQuery.readyList = null; } } } }); new function(){ var e = ("blur,focus,load,resize,scroll,unload,click,dblclick," + "mousedown,mouseup,mousemove,mouseover,mouseout,change,reset,select," + "submit,keydown,keypress,keyup,error").split(","); // Go through all the event names, but make sure that // it is enclosed properly for ( var i = 0; i < e.length; i++ ) new function(){ var o = e[i]; // Handle event binding jQuery.fn[o] = function(f){ return f ? this.bind(o, f) : this.trigger(o); }; // Handle event unbinding jQuery.fn["un"+o] = function(f){ return this.unbind(o, f); }; // Finally, handle events that only fire once jQuery.fn["one"+o] = function(f){ // Attach the event listener return this.each(function(){ var count = 0; // Add the event jQuery.event.add( this, o, function(e){ // If this function has already been executed, stop if ( count++ ) return; // And execute the bound function return f.apply(this, [e]); }); }); }; }; // If Mozilla is used if ( jQuery.browser.mozilla || jQuery.browser.opera ) { // Use the handy event callback document.addEventListener( "DOMContentLoaded", jQuery.ready, false ); // If IE is used, use the excellent hack by Matthias Miller // http://www.outofhanwell.com/blog/index.php?title=the_window_onload_problem_revisited } else if ( jQuery.browser.msie ) { // Only works if you document.write() it document.write("<\/script>"); // Use the defer script hack var script = document.getElementById("__ie_init"); script.onreadystatechange = function() { if ( this.readyState != "complete" ) return; this.parentNode.removeChild( this ); jQuery.ready(); }; // Clear from memory script = null; // If Safari is used } else if ( jQuery.browser.safari ) { // Continually check to see if the document.readyState is valid jQuery.safariTimer = setInterval(function(){ // loaded and complete are both valid states if ( document.readyState == "loaded" || document.readyState == "complete" ) { // If either one are found, remove the timer clearInterval( jQuery.safariTimer ); jQuery.safariTimer = null; // and execute any waiting functions jQuery.ready(); } }, 10); } // A fallback to window.onload, that will always work jQuery.event.add( window, "load", jQuery.ready ); }; jQuery.fn.extend({ // overwrite the old show method _show: jQuery.fn.show, show: function(speed,callback){ return speed ? this.animate({ height: "show", width: "show", opacity: "show" }, speed, callback) : this._show(); }, // Overwrite the old hide method _hide: jQuery.fn.hide, hide: function(speed,callback){ return speed ? this.animate({ height: "hide", width: "hide", opacity: "hide" }, speed, callback) : this._hide(); }, slideDown: function(speed,callback){ return this.animate({height: "show"}, speed, callback); }, slideUp: function(speed,callback){ return this.animate({height: "hide"}, speed, callback); }, slideToggle: function(speed,callback){ return this.each(function(){ var state = $(this).is(":hidden") ? "show" : "hide"; $(this).animate({height: state}, speed, callback); }); }, fadeIn: function(speed,callback){ return this.animate({opacity: "show"}, speed, callback); }, fadeOut: function(speed,callback){ return this.animate({opacity: "hide"}, speed, callback); }, fadeTo: function(speed,to,callback){ return this.animate({opacity: to}, speed, callback); }, animate: function(prop,speed,callback) { return this.queue(function(){ this.curAnim = prop; for ( var p in prop ) { var e = new jQuery.fx( this, jQuery.speed(speed,callback), p ); if ( prop[p].constructor == Number ) e.custom( e.cur(), prop[p] ); else e[ prop[p] ]( prop ); } }); }, queue: function(type,fn){ if ( !fn ) { fn = type; type = "fx"; } return this.each(function(){ if ( !this.queue ) this.queue = {}; if ( !this.queue[type] ) this.queue[type] = []; this.queue[type].push( fn ); if ( this.queue[type].length == 1 ) fn.apply(this); }); } }); jQuery.extend({ setAuto: function(e,p) { if ( e.notAuto ) return; if ( p == "height" && e.scrollHeight != parseInt(jQuery.curCSS(e,p)) ) return; if ( p == "width" && e.scrollWidth != parseInt(jQuery.curCSS(e,p)) ) return; // Remember the original height var a = e.style[p]; // Figure out the size of the height right now var o = jQuery.curCSS(e,p,1); if ( p == "height" && e.scrollHeight != o || p == "width" && e.scrollWidth != o ) return; // Set the height to auto e.style[p] = e.currentStyle ? "" : "auto"; // See what the size of "auto" is var n = jQuery.curCSS(e,p,1); // Revert back to the original size if ( o != n && n != "auto" ) { e.style[p] = a; e.notAuto = true; } }, speed: function(s,o) { o = o || {}; if ( o.constructor == Function ) o = { complete: o }; var ss = { slow: 600, fast: 200 }; o.duration = (s && s.constructor == Number ? s : ss[s]) || 400; // Queueing o.oldComplete = o.complete; o.complete = function(){ jQuery.dequeue(this, "fx"); if ( o.oldComplete && o.oldComplete.constructor == Function ) o.oldComplete.apply( this ); }; return o; }, queue: {}, dequeue: function(elem,type){ type = type || "fx"; if ( elem.queue && elem.queue[type] ) { // Remove self elem.queue[type].shift(); // Get next function var f = elem.queue[type][0]; if ( f ) f.apply( elem ); } }, /* * I originally wrote fx() as a clone of moo.fx and in the process * of making it small in size the code became illegible to sane * people. You've been warned. */ fx: function( elem, options, prop ){ var z = this; // The users options z.o = { duration: options.duration || 400, complete: options.complete, step: options.step }; // The element z.el = elem; // The styles var y = z.el.style; // Simple function for setting a style value z.a = function(){ if ( options.step ) options.step.apply( elem, [ z.now ] ); if ( prop == "opacity" ) { if (jQuery.browser.mozilla && z.now == 1) z.now = 0.9999; if (window.ActiveXObject) y.filter = "alpha(opacity=" + z.now*100 + ")"; else y.opacity = z.now; // My hate for IE will never die } else if ( parseInt(z.now) ) y[prop] = parseInt(z.now) + "px"; y.display = "block"; }; // Figure out the maximum number to run to z.max = function(){ return parseFloat( jQuery.css(z.el,prop) ); }; // Get the current size z.cur = function(){ var r = parseFloat( jQuery.curCSS(z.el, prop) ); return r && r > -10000 ? r : z.max(); }; // Start an animation from one number to another z.custom = function(from,to){ z.startTime = (new Date()).getTime(); z.now = from; z.a(); z.timer = setInterval(function(){ z.step(from, to); }, 13); }; // Simple 'show' function z.show = function( p ){ if ( !z.el.orig ) z.el.orig = {}; // Remember where we started, so that we can go back to it later z.el.orig[prop] = this.cur(); z.custom( 0, z.el.orig[prop] ); // Stupid IE, look what you made me do if ( prop != "opacity" ) y[prop] = "1px"; }; // Simple 'hide' function z.hide = function(){ if ( !z.el.orig ) z.el.orig = {}; // Remember where we started, so that we can go back to it later z.el.orig[prop] = this.cur(); z.o.hide = true; // Begin the animation z.custom(z.el.orig[prop], 0); }; // IE has trouble with opacity if it does not have layout if ( jQuery.browser.msie && !z.el.currentStyle.hasLayout ) y.zoom = "1"; // Remember the overflow of the element if ( !z.el.oldOverlay ) z.el.oldOverflow = jQuery.css( z.el, "overflow" ); // Make sure that nothing sneaks out y.overflow = "hidden"; // Each step of an animation z.step = function(firstNum, lastNum){ var t = (new Date()).getTime(); if (t > z.o.duration + z.startTime) { // Stop the timer clearInterval(z.timer); z.timer = null; z.now = lastNum; z.a(); z.el.curAnim[ prop ] = true; var done = true; for ( var i in z.el.curAnim ) if ( z.el.curAnim[i] !== true ) done = false; if ( done ) { // Reset the overflow y.overflow = z.el.oldOverflow; // Hide the element if the "hide" operation was done if ( z.o.hide ) y.display = 'none'; // Reset the property, if the item has been hidden if ( z.o.hide ) { for ( var p in z.el.curAnim ) { y[ p ] = z.el.orig[p] + ( p == "opacity" ? "" : "px" ); // set its height and/or width to auto if ( p == 'height' || p == 'width' ) jQuery.setAuto( z.el, p ); } } } // If a callback was provided, execute it if( done && z.o.complete && z.o.complete.constructor == Function ) // Execute the complete function z.o.complete.apply( z.el ); } else { // Figure out where in the animation we are and set the number var p = (t - this.startTime) / z.o.duration; z.now = ((-Math.cos(p*Math.PI)/2) + 0.5) * (lastNum-firstNum) + firstNum; // Perform the next step of the animation z.a(); } }; } }); // AJAX Plugin // Docs Here: // http://jquery.com/docs/ajax/ jQuery.fn.loadIfModified = function( url, params, callback ) { this.load( url, params, callback, 1 ); }; jQuery.fn.load = function( url, params, callback, ifModified ) { if ( url.constructor == Function ) return this.bind("load", url); callback = callback || function(){}; // Default to a GET request var type = "GET"; // If the second parameter was provided if ( params ) { // If it's a function if ( params.constructor == Function ) { // We assume that it's the callback callback = params; params = null; // Otherwise, build a param string } else { params = jQuery.param( params ); type = "POST"; } } var self = this; // Request the remote document jQuery.ajax( type, url, params,function(res, status){ if ( status == "success" || !ifModified && status == "notmodified" ) { // Inject the HTML into all the matched elements self.html(res.responseText).each( callback, [res.responseText, status] ); // Execute all the scripts inside of the newly-injected HTML $("script", self).each(function(){ if ( this.src ) $.getScript( this.src ); else eval.call( window, this.text || this.textContent || this.innerHTML || "" ); }); } else callback.apply( self, [res.responseText, status] ); }, ifModified); return this; }; // If IE is used, create a wrapper for the XMLHttpRequest object if ( jQuery.browser.msie && typeof XMLHttpRequest == "undefined" ) XMLHttpRequest = function(){ return new ActiveXObject( navigator.userAgent.indexOf("MSIE 5") >= 0 ? "Microsoft.XMLHTTP" : "Msxml2.XMLHTTP" ); }; // Attach a bunch of functions for handling common AJAX events new function(){ var e = "ajaxStart,ajaxStop,ajaxComplete,ajaxError,ajaxSuccess".split(','); for ( var i = 0; i < e.length; i++ ) new function(){ var o = e[i]; jQuery.fn[o] = function(f){ return this.bind(o, f); }; }; }; jQuery.extend({ get: function( url, data, callback, type, ifModified ) { if ( data.constructor == Function ) { type = callback; callback = data; data = null; } if ( data ) url += "?" + jQuery.param(data); // Build and start the HTTP Request jQuery.ajax( "GET", url, null, function(r, status) { if ( callback ) callback( jQuery.httpData(r,type), status ); }, ifModified); }, getIfModified: function( url, data, callback, type ) { jQuery.get(url, data, callback, type, 1); }, getScript: function( url, data, callback ) { jQuery.get(url, data, callback, "script"); }, post: function( url, data, callback, type ) { // Build and start the HTTP Request jQuery.ajax( "POST", url, jQuery.param(data), function(r, status) { if ( callback ) callback( jQuery.httpData(r,type), status ); }); }, // timeout (ms) timeout: 0, ajaxTimeout: function(timeout) { jQuery.timeout = timeout; }, // Last-Modified header cache for next request lastModified: {}, ajax: function( type, url, data, ret, ifModified ) { // If only a single argument was passed in, // assume that it is a object of key/value pairs if ( !url ) { ret = type.complete; var success = type.success; var error = type.error; data = type.data; url = type.url; type = type.type; } // Watch for a new set of requests if ( ! jQuery.active++ ) jQuery.event.trigger( "ajaxStart" ); var requestDone = false; // Create the request object var xml = new XMLHttpRequest(); // Open the socket xml.open(type || "GET", url, true); // Set the correct header, if data is being sent if ( data ) xml.setRequestHeader("Content-Type", "application/x-www-form-urlencoded"); // Set the If-Modified-Since header, if ifModified mode. if ( ifModified ) xml.setRequestHeader("If-Modified-Since", jQuery.lastModified[url] || "Thu, 01 Jan 1970 00:00:00 GMT" ); // Set header so calling script knows that it's an XMLHttpRequest xml.setRequestHeader("X-Requested-With", "XMLHttpRequest"); // Make sure the browser sends the right content length if ( xml.overrideMimeType ) xml.setRequestHeader("Connection", "close"); // Wait for a response to come back var onreadystatechange = function(istimeout){ // The transfer is complete and the data is available, or the request timed out if ( xml && (xml.readyState == 4 || istimeout == "timeout") ) { requestDone = true; var status = jQuery.httpSuccess( xml ) && istimeout != "timeout" ? ifModified && jQuery.httpNotModified( xml, url ) ? "notmodified" : "success" : "error"; // Make sure that the request was successful or notmodified if ( status != "error" ) { // Cache Last-Modified header, if ifModified mode. var modRes = xml.getResponseHeader("Last-Modified"); if ( ifModified && modRes ) jQuery.lastModified[url] = modRes; // If a local callback was specified, fire it if ( success ) success( xml, status ); // Fire the global callback jQuery.event.trigger( "ajaxSuccess" ); // Otherwise, the request was not successful } else { // If a local callback was specified, fire it if ( error ) error( xml, status ); // Fire the global callback jQuery.event.trigger( "ajaxError" ); } // The request was completed jQuery.event.trigger( "ajaxComplete" ); // Handle the global AJAX counter if ( ! --jQuery.active ) jQuery.event.trigger( "ajaxStop" ); // Process result if ( ret ) ret(xml, status); // Stop memory leaks xml.onreadystatechange = function(){}; xml = null; } }; xml.onreadystatechange = onreadystatechange; // Timeout checker if(jQuery.timeout > 0) setTimeout(function(){ // Check to see if the request is still happening if (xml) { // Cancel the request xml.abort(); if ( !requestDone ) onreadystatechange( "timeout" ); // Clear from memory xml = null; } }, jQuery.timeout); // Send the data xml.send(data); }, // Counter for holding the number of active queries active: 0, // Determines if an XMLHttpRequest was successful or not httpSuccess: function(r) { try { return !r.status && location.protocol == "file:" || ( r.status >= 200 && r.status < 300 ) || r.status == 304 || jQuery.browser.safari && r.status == undefined; } catch(e){} return false; }, // Determines if an XMLHttpRequest returns NotModified httpNotModified: function(xml, url) { try { var xmlRes = xml.getResponseHeader("Last-Modified"); // Firefox always returns 200. check Last-Modified date return xml.status == 304 || xmlRes == jQuery.lastModified[url] || jQuery.browser.safari && xml.status == undefined; } catch(e){} return false; }, // Get the data out of an XMLHttpRequest. // Return parsed XML if content-type header is "xml" and type is "xml" or omitted, // otherwise return plain text. httpData: function(r,type) { var ct = r.getResponseHeader("content-type"); var data = !type && ct && ct.indexOf("xml") >= 0; data = type == "xml" || data ? r.responseXML : r.responseText; // If the type is "script", eval it if ( type == "script" ) eval.call( window, data ); // Get the JavaScript object, if JSON is used. if ( type == "json" ) eval( "data = " + data ); return data; }, // Serialize an array of form elements or a set of // key/values into a query string param: function(a) { var s = []; // If an array was passed in, assume that it is an array // of form elements if ( a.constructor == Array ) { // Serialize the form elements for ( var i = 0; i < a.length; i++ ) s.push( a[i].name + "=" + encodeURIComponent( a[i].value ) ); // Otherwise, assume that it's an object of key/value pairs } else { // Serialize the key/values for ( var j in a ) s.push( j + "=" + encodeURIComponent( a[j] ) ); } // Return the resulting serialization return s.join("&"); } }); PKù 05O1|8éé$ticketdelete/htdocs/ticketdelete.css.inlinebuttons a { font-size: 87%; border-width: 1px; border-style: dotted; border-color: #ccc; margin: 0; padding: 0.1em; background: none; color: #000; } .inlinebuttons a:hover { color: #000; background-color: #ccb; } PKT15*¿e#ticketdelete/htdocs/ticketdelete.js$(document).ready(function() { var ticket = /\/ticket\/(\d+)/.exec(document.location)[1]; var delete_link = 'Delete'; var ticket_buttons = $('#ticket .inlinebuttons')[0]; if (ticket_buttons) { $(ticket_buttons).append(delete_link); } else { $('#ticket table.properties').after('

'+delete_link+' 

'); } $('#changelog h3').each(function() { var comment = $('input[@name=replyto]', this)[0]; if (comment) { comment = comment.value; $('.inlinebuttons', this).append('Delete'); } }); }); PKµŽM5«èZééé,ticketdelete/templates/ticketdelete_admin.cs

Delete Ticket Changes


Back

Note: This is intended only for use in very odd circumstances.
It is usually a better idea to resolve a ticket as invalid, than to remove it from the database.

Ticket ID:
Again:

Please selet a change to delete

 FieldOld ValueNew Value 
checked="checked"/> Change at by
checked="checked"/>


Back

Select a ticket ID to change.

Ticket ID:

PKâ„68“×2EGG-INFO/zip-safe PKÕ„68Ò$ æ++EGG-INFO/SOURCES.txtsetup.py TracTicketDelete.egg-info/PKG-INFO TracTicketDelete.egg-info/SOURCES.txt TracTicketDelete.egg-info/dependency_links.txt TracTicketDelete.egg-info/entry_points.txt TracTicketDelete.egg-info/requires.txt TracTicketDelete.egg-info/top_level.txt ticketdelete/__init__.py ticketdelete/web_ui.py PKÔ„68—ÃÞ::EGG-INFO/entry_points.txt[trac.plugins] ticketdelete.web_ui = ticketdelete.web_ui PKÔ„68“×2EGG-INFO/dependency_links.txt PKÔ„68nH–££EGG-INFO/PKG-INFOMetadata-Version: 1.0 Name: TracTicketDelete Version: 1.1.4 Summary: Remove tickets and ticket changes from Trac. Home-page: http://trac-hacks.org/wiki/TicketDeletePlugin Author: Noah Kantrowitz Author-email: coderanger@yahoo.com License: BSD Description: Provides a web interface to removing whole tickets and ticket changes in Trac. Keywords: trac plugin ticket delete Platform: UNKNOWN Classifier: Framework :: Trac PKÓ„68¢|‘õ EGG-INFO/requires.txtTracWebAdminPKÔ„68$@ EGG-INFO/top_level.txtticketdelete PK(€q4­ðÖu¤ticketdelete/__init__.pyPKÝ„68øßÖ¦¦¤Kticketdelete/__init__.pyoPKØ„68¸ã^@Ó)Ó)¤(ticketdelete/web_ui.pycPKÝ„68 Ë ‚)‚)¤0+ticketdelete/web_ui.pyoPKׄ68øßÖ¦¦¤çTticketdelete/__init__.pycPK.:l5æ^É`Ý$Ý$¤ÄUticketdelete/web_ui.pyPKn 05.­>Ò²Ò²¤Õzticketdelete/htdocs/jquery.jsPKù 05O1|8éé$¤â-ticketdelete/htdocs/ticketdelete.cssPKT15*¿e#¤ /ticketdelete/htdocs/ticketdelete.jsPKµŽM5«èZééé,¤R2ticketdelete/templates/ticketdelete_admin.csPKâ„68“×2¤…DEGG-INFO/zip-safePKÕ„68Ò$ æ++¤µDEGG-INFO/SOURCES.txtPKÔ„68—ÃÞ::¤FEGG-INFO/entry_points.txtPKÔ„68“×2¤ƒFEGG-INFO/dependency_links.txtPKÔ„68nH–££¤¿FEGG-INFO/PKG-INFOPKÓ„68¢|‘õ ¤‘HEGG-INFO/requires.txtPKÔ„68$@ ¤ÐHEGG-INFO/top_level.txtPKÃI